PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00132.1.g00350.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 363aa    MW: 39027.8 Da    PI: 9.5214
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00132.1.g00350.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32237292156
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                     k r++W+peLH++Fv a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zjn_sc00132.1.g00350.1.am.mkhc 237 KSRRCWSPELHRQFVAALNQLGGPQVATPKQIRELMKVEGLTNDEVKSHLQKYRLH 292
                                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.951234294IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-29235295IPR009057Homeodomain-like
SuperFamilySSF466894.03E-17235295IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-25237292IPR006447Myb domain, plants
PfamPF002493.9E-7239290IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGLDVGEIGM GADLSLDLRH FAARAMRQSK NAPPASDMDA YIRRLEEERG KIEVFRRELP  60
ICARLLADVI DVMKEEAEKK KRNDRKEDEA GDKSKWMSTA QLWTGGSGRD AAETEKQDKR  120
TSSSSSEPKS CGGAFTPFKA VGSGAPAFGR PCLRNDDKAA GVGTPPDLSP LSPPAVKSVP  180
AGAADKSNRQ VLGFAQAAAR AAAMVPSGPA LSGLQRQPQQ TTPPPQQQQQ QQQQARKSRR  240
CWSPELHRQF VAALNQLGGP QVATPKQIRE LMKVEGLTND EVKSHLQKYR LHNRRTPAGS  300
TVVSQPIVLV GGLWIPQEQS SSQSGSPQGP LHFSTSAGVA VSSTAATASC EEEDGRSESD  360
GWK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459272.11e-157hypothetical protein SORBIDRAFT_02g001600
TrEMBLA0A0C4MLG71e-159A0A0C4MLG7_9POAL; Uncharacterized protein
STRINGSb02g001600.11e-157(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.13e-32G2-like family protein